Chic&ShinesChic&ShinesChic&Shines
  • Français
  • English
  • Español
0
0
Robe courte sans manches en mousseline

Robe courte sans manches en mousseline

Size Guide

€29,99

Tax included. Shipping calculated at checkout.
✔ Shipping (10 to 15 days)
✔ Returns and exchanges within 30 days
✔ Money back guarantee

Color: Black

  • Black
  • Khaki
  • Pink
  • Purple

Size: 2XL

  • 2XL
  • L
  • M
  • S
  • XL
Will not ship until [19041994]
Out of stock
Add to Wishlist

american expressdiscovermaestromasterpaypalvisascalapayklarna
Description

Découvrez cette robe courte sans manches en mousseline, parfaite pour allier légèreté et élégance. Sa matière fluide offre un confort optimal tout en sublimant votre silhouette. Idéale pour les journées chaudes ou les soirées estivales, elle vous assure un style raffiné et féminin en toute simplicité. Adoptez-la pour une allure chic et décontractée qui ne passera pas inaperçue.

Type : robe courte

Style : élégant, sortie, sexy, 

Type de taille : taille moyenne

Motif : couleur unie

Nom du tissu : mousseline 

Type de manche : sans manches 

Composition principale du tissu : polyester
 

FAQ

How much does it cost to ship my order?

- Metropolitan France

  • Standard delivery (10 to 15 days) at €8.00
  • Express delivery (7 to 10 days) at €14.00 and FREE from €49.00 of purchase.

- For the French overseas departments and territories

  • Standard delivery (15 to 20 days) at €19.99
  • Express delivery (10 to 15 days) at €38.00 or FREE from €129.00 of purchase.

- In Europe

  • Standard delivery (10 to 15 days) at €8.00
  • Express delivery (7 to 10 days) at €14.00 and FREE from €100.00 of purchase.

- Rest of the world

  • Standard delivery (10 to 15 days) at €9.00
  • Express delivery (7 to 10 days) at €15.00 and FREE from €150.00 of purchase.
What are your delivery times?

You will receive your order within a maximum of 10 to 15 days for standard delivery or 7 to 10 days for express delivery after processing your order. A confirmation email with your tracking number will be sent to you as soon as your package is shipped from our warehouse.

How do I track my order?

As soon as your order is shipped from our warehouses you will receive a tracking link by email allowing you to follow its progress.

Do you ship worldwide?

Yes, absolutely. We ship worldwide.

Do you have a refund policy?

We do our best to resolve any issues our customers may have with their online items. If you still wish to receive a refund on your order, we can of course process the payment, provided that the claim is made within 30 days of the order date and the product(s) concerned are not on sale. For more information, please read more about our refund policy.

What payment methods are available?

We accept all major credit cards (VISA, MasterCard, AMEX) as well as payments via Scalapay 3x without fees and PayPal. However, we do not accept checks, money orders or bank transfers.

INTERNATIONAL DELIVERY

You don't live in France? No problem, we deliver all over the world!

24 HOUR ASSISTANCE

A dedicated support team to answer all your questions.

SATISFIED OR REFUNDED

We offer 7 days satisfaction or refund after receiving the items!

SECURE PAYMENT

We guarantee 100% secure payment

Sunday,Monday,Tuesday,Wednesday,Thursday,Friday,Saturday
January,February,March,April,May,June,July,August,September,October,November,December
Not enough items available. Only [max] left.
Add to WishlistBrowse WishlistRemove Wishlist
Shopping cart

Your cart is empty.

Return to the shop

Enable cookies to use the shopping cart
Subtotal:
€0,00

Robe courte sans manches en mousseline

Black / 2XL
Black / 2XL
€29,99
We use cookies to improve your experience on our website. By browsing this site, you agree to our use of cookies.
More infoAccept