Chic&ShinesChic&ShinesChic&Shines
  • Français
  • English
  • Español
0
0
Ensemble haut et pantalon large

Ensemble haut et pantalon large

Size Guide

€39,99

Tax included. Shipping calculated at checkout.
✔ Shipping (10 to 15 days)
✔ Returns and exchanges within 30 days
✔ Money back guarantee

Couleur: NOIR

  • NOIR

Taille: S

  • S
  • M
  • L
  • XL
Will not ship until [19041994]
Out of stock
Add to Wishlist

american expressdiscovermaestromasterpaypalvisascalapayklarna
Description

Adoptez un style estival élégant et confortable avec cet ensemble composé d’un haut léger et d’un pantalon large. Idéal pour vos journées décontractées, ce duo allie liberté de mouvement et fraîcheur grâce à sa coupe ample, parfaite pour affronter la chaleur avec élégance. Polyvalent et facile à assortir, il deviendra vite un incontournable de votre garde-robe estivale.

Type : ensemble haut pantalon

Style : été, décontracté, loisir, vacance

Motif : Abstrait

Longueur des manches : demi-manche

Longueur du pantalon : pantalon

Composition du tissu : Polyester (fibre de polyester)

Notice

FAQ

How much does it cost to ship my order?

- Metropolitan France

  • Standard delivery (10 to 15 days) at €8.00
  • Express delivery (7 to 10 days) at €14.00 and FREE from €49.00 of purchase.

- For the French overseas departments and territories

  • Standard delivery (15 to 20 days) at €19.99
  • Express delivery (10 to 15 days) at €38.00 or FREE from €129.00 of purchase.

- In Europe

  • Standard delivery (10 to 15 days) at €8.00
  • Express delivery (7 to 10 days) at €14.00 and FREE from €100.00 of purchase.

- Rest of the world

  • Standard delivery (10 to 15 days) at €9.00
  • Express delivery (7 to 10 days) at €15.00 and FREE from €150.00 of purchase.
What are your delivery times?

You will receive your order within a maximum of 10 to 15 days for standard delivery or 7 to 10 days for express delivery after processing your order. A confirmation email with your tracking number will be sent to you as soon as your package is shipped from our warehouse.

How do I track my order?

As soon as your order is shipped from our warehouses you will receive a tracking link by email allowing you to follow its progress.

Do you ship worldwide?

Yes, absolutely. We ship worldwide.

Do you have a refund policy?

We do our best to resolve any issues our customers may have with their online items. If you still wish to receive a refund on your order, we can of course process the payment, provided that the claim is made within 30 days of the order date and the product(s) concerned are not on sale. For more information, please read more about our refund policy.

What payment methods are available?

We accept all major credit cards (VISA, MasterCard, AMEX) as well as payments via Scalapay 3x without fees and PayPal. However, we do not accept checks, money orders or bank transfers.

INTERNATIONAL DELIVERY

You don't live in France? No problem, we deliver all over the world!

24 HOUR ASSISTANCE

A dedicated support team to answer all your questions.

SATISFIED OR REFUNDED

We offer 7 days satisfaction or refund after receiving the items!

SECURE PAYMENT

We guarantee 100% secure payment

Sunday,Monday,Tuesday,Wednesday,Thursday,Friday,Saturday
January,February,March,April,May,June,July,August,September,October,November,December
Not enough items available. Only [max] left.
Add to WishlistBrowse WishlistRemove Wishlist
Shopping cart

Your cart is empty.

Return to the shop

Enable cookies to use the shopping cart
Subtotal:
€0,00

Ensemble haut et pantalon large

NOIR / S
NOIR / S
€39,99
We use cookies to improve your experience on our website. By browsing this site, you agree to our use of cookies.
More infoAccept