Chic&ShinesChic&ShinesChic&Shines
  • Français
  • English
  • Español
0
0
Robe longue fendue col licou dos nu

Robe longue fendue col licou dos nu

Size Guide

€25,50

Tax included. Shipping calculated at checkout.
✔ Shipping (10 to 15 days)
✔ Returns and exchanges within 30 days
✔ Money back guarantee

Couleur: NOIR

  • NOIR
  • BLANC
  • ROUGE VIN

Taille: XS

  • XS
  • S
  • M
  • L
Will not ship until [19041994]
Out of stock
Add to Wishlist

american expressdiscovermaestromasterpaypalvisascalapayklarna
Description

Cette robe longue moulante fendue sublime votre silhouette avec élégance et sensualité. Sa coupe fluide met en valeur vos jambes tout en offrant un confort optimal. Parfaite pour une soirée chic ou un événement spécial, elle allie charme et audace pour vous faire briller en toute confiance.

Type : robe

Style : élégant, décontracté, sortie, loisir, sexy

Motif : couleur unie

Type col : licou

Longueur de la jupe : jupe longue

Composition principale du tissu : fibre de polyester

Notice

FAQ

How much does it cost to ship my order?

- Metropolitan France

  • Standard delivery (10 to 15 days) at €8.00
  • Express delivery (7 to 10 days) at €14.00 and FREE from €49.00 of purchase.

- For the French overseas departments and territories

  • Standard delivery (15 to 20 days) at €19.99
  • Express delivery (10 to 15 days) at €38.00 or FREE from €129.00 of purchase.

- In Europe

  • Standard delivery (10 to 15 days) at €8.00
  • Express delivery (7 to 10 days) at €14.00 and FREE from €100.00 of purchase.

- Rest of the world

  • Standard delivery (10 to 15 days) at €9.00
  • Express delivery (7 to 10 days) at €15.00 and FREE from €150.00 of purchase.
What are your delivery times?

You will receive your order within a maximum of 10 to 15 days for standard delivery or 7 to 10 days for express delivery after processing your order. A confirmation email with your tracking number will be sent to you as soon as your package is shipped from our warehouse.

How do I track my order?

As soon as your order is shipped from our warehouses you will receive a tracking link by email allowing you to follow its progress.

Do you ship worldwide?

Yes, absolutely. We ship worldwide.

Do you have a refund policy?

We do our best to resolve any issues our customers may have with their online items. If you still wish to receive a refund on your order, we can of course process the payment, provided that the claim is made within 30 days of the order date and the product(s) concerned are not on sale. For more information, please read more about our refund policy.

What payment methods are available?

We accept all major credit cards (VISA, MasterCard, AMEX) as well as payments via Scalapay 3x without fees and PayPal. However, we do not accept checks, money orders or bank transfers.

INTERNATIONAL DELIVERY

You don't live in France? No problem, we deliver all over the world!

24 HOUR ASSISTANCE

A dedicated support team to answer all your questions.

SATISFIED OR REFUNDED

We offer 7 days satisfaction or refund after receiving the items!

SECURE PAYMENT

We guarantee 100% secure payment

Sunday,Monday,Tuesday,Wednesday,Thursday,Friday,Saturday
January,February,March,April,May,June,July,August,September,October,November,December
Not enough items available. Only [max] left.
Add to WishlistBrowse WishlistRemove Wishlist
Shopping cart

Your cart is empty.

Return to the shop

Enable cookies to use the shopping cart
Subtotal:
€0,00

Robe longue fendue col licou dos nu

NOIR / XS
NOIR / XS
€25,50
We use cookies to improve your experience on our website. By browsing this site, you agree to our use of cookies.
More infoAccept