Chic&ShinesChic&ShinesChic&Shines
0

Combinaison pantalon sans manches en strass

€49,99

Tax included. Shipping calculated at checkout.
✔ Shipping (10 to 15 days)
✔ Returns and exchanges within 30 days
✔ Money back guarantee

Couleur: NOIR

  • NOIR
  • BRONZE
  • ROUGE
  • GRIS

Taille: L

  • L
  • XL
  • 2XL
  • 3XL
  • 4XL
  • 5XL
  • S
  • M
Will not ship until [19041994]
Out of stock

american expressdiscovermaestromasterpaypalvisascalapayklarna

Cette combinaison pantalon sans manches ornée de strass apporte une touche d'élégance scintillante à votre tenue. Sa coupe fluide et sans manches assure confort et liberté de mouvement, idéale pour briller lors de vos soirées ou événements spéciaux. Adoptez un style sophistiqué et audacieux avec ce vêtement qui capte la lumière à chaque pas.

Type : combinaison pantalon

Style : chic, fête, soirée, sortie

Motif : couleur uni

Type de col : col rond

Nom du tissu : polyester, strass

FAQ

- Metropolitan France

  • Standard delivery (10 to 15 days) at €8.00
  • Express delivery (7 to 10 days) at €14.00 and FREE from €49.00 of purchase.

- For the French overseas departments and territories

  • Standard delivery (15 to 20 days) at €19.99
  • Express delivery (10 to 15 days) at €38.00 or FREE from €129.00 of purchase.

- In Europe

  • Standard delivery (10 to 15 days) at €8.00
  • Express delivery (7 to 10 days) at €14.00 and FREE from €100.00 of purchase.

- Rest of the world

  • Standard delivery (10 to 15 days) at €9.00
  • Express delivery (7 to 10 days) at €15.00 and FREE from €150.00 of purchase.

You will receive your order within a maximum of 10 to 15 days for standard delivery or 7 to 10 days for express delivery after processing your order. A confirmation email with your tracking number will be sent to you as soon as your package is shipped from our warehouse.

As soon as your order is shipped from our warehouses you will receive a tracking link by email allowing you to follow its progress.

Yes, absolutely. We ship worldwide.

We do our best to resolve any issues our customers may have with their online items. If you still wish to receive a refund on your order, we can of course process the payment, provided that the claim is made within 30 days of the order date and the product(s) concerned are not on sale. For more information, please read more about our refund policy.

We accept all major credit cards (VISA, MasterCard, AMEX) as well as payments via Scalapay 3x without fees and PayPal. However, we do not accept checks, money orders or bank transfers.

INTERNATIONAL DELIVERY

You don't live in France? No problem, we deliver all over the world!

24 HOUR ASSISTANCE

A dedicated support team to answer all your questions.

SATISFIED OR REFUNDED

We offer 7 days satisfaction or refund after receiving the items!

SECURE PAYMENT

We guarantee 100% secure payment

Sunday,Monday,Tuesday,Wednesday,Thursday,Friday,Saturday
January,February,March,April,May,June,July,August,September,October,November,December
Not enough items available. Only [max] left.
Add to WishlistBrowse WishlistRemove Wishlist
Shopping cart

Your cart is empty.

Return to the shop

Combinaison pantalon sans manches en strass

NOIR / L
NOIR / L
€49,99